SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). Flexible Throughput Read one sample or up to 384 at a time – it’s your choice. Each sample has a discrete sample beam and reference beam. 6-, 12-,. DNA provides the same sensitivity as a spectrophotometer. With three modes of detection for full spectrum absorbance, fluorescence and luminescence, It is user upgradeable from 2 to 3 modes. . The optical performance is comparable to a top-of-the-line dedicated Unparalleled performance on a personalized platform. SpectraMax Plus384, 190, 340PC384, and VersaMax User Guide Molecular Devices User Guide SpectraMax Paradigm Microplate Reader General specifications User-upgradeable Multi-Mode Detection Platform Technical specifications Optimized Guaranteed* Fluorescence Intensity (FI) (Fluorescein) 96-well (200 µL) 0. craig@californialightworks. Clearance . ) 8. The SpectraMax® Gemini™ EM Microplate Spectrofluorometer from Molecular Devices® provides a flexible environment. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. Page 14: Component Description† Bottom mounting for SpectraMax Paradigm Readers only. where. Related Products: SpectraMax 384 Plus UV/Vis Microplate Reader, Molecular Devices SpectraMax M2e Microplate Readers, Molecular Devices SpectraMax M5 Multi-Mode Microplate Reader,. Capabilities include fluorescence and luminescence readings, environmental control, cell viability assays, enzyme. 304 signal level saturation. The SpectraMax® Paradigm® Multi-Mode Microplate Reader measures absorbance, fluorescence, time-resolved fluorescence (including HTRF), fluorescence polarization, AlphaScreen®, AlphaLISA®, and luminescence assays for up to 1536-well plates. Table 2. 0. com Check our website for a current listing of worldwide distributors. Simplified microplate washing from single-tube dispensing to washing full 96- and 384-well plates. The SPECTRAmax™ 340PC 384 microplate spectrophotometer provides rapid and sensitive measurements of a variety of analytes across a wide range of concentrations. SpectraMax190reads96-wellplates. Features. When reading optical density at wavelengths below 340 nm, special UVtransparent, disposableFor SpectraMax ABS Plus reader, r 2 = 0. Reliable performance with a proven track record. 315 can't find zero order. 316 grating motor driver faulty. 6 (H) x 22. Standard features include UV-visible absorbance in tunable 1,0 nm increments up to 4,0 nm, and fluorescence intensity with spectral scanning across the wavelength range in 1 nm increments and up to four wavelength pairs per protocol. For the SpectraMax Plus 384 you can do fixed point cuvette reads. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. The SoftMax® Pro Data Acquisition and Analysis Software controls Molecular Devices® spectrophotometers and absorbance, luminescence, and fluorescence microplate readers andThe absorbance at 450 nm was measured with a microplate reader (SPECTRAmax 384, Molecular Devices, United States). Paradigm spectramax manualslibSpectramax id5 Molecular devices spectramax plus 384 user manual pdf downloadShaking spectramax id3 frequently. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. The optical performance is comparable to a top-of-the-line dedicated Which SpectraMax M Series reader do you need? SpectraMax M Series Multi-Mode Microplate Readers 5 Ordering information VWR cat. , FI 45 sec. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. The SpectraMax® 340 PC 384 Absorbance Microplate Reader from Molecular Devices provides the necessary tools for absorbance measurements in the visible range. Page 10 Cuvette Chamber The cuvette chamber on the SpectraMax Plus 384 is located at the right front of the instrument. ¨The SpectraMax M2 is a dual-monochromator, multi-detection microplate reader with a dual-mode cuvette port and 96 or 384 microplate reading capability. Biocompare is the leading. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export dataThe SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. This user guide provides detailed instructions on how to set up, run, and analyze the validation tests, as well as how to troubleshoot common issues. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. microplates or in a cuvette at a. For very concentrated samples, use a minimumThe ProcartaPlex 384-well format was specifically developed to increase sample throughput while maintaining the robustness of a 96-well assay. SpectraMax® 340PC384 Microplate Reader for acquiring data in endpoint, kinetic, and spectral scan modes using wavelegths from 340-850 nm, tunable in 1 nm increments. 7. 0. The 190 can read across the entirety of the UV-Vis. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. 5 mP. Reads 96-well microplates in 5 seconds; Reads 384-well microplates in 16 seconds, Monochromator, tunable 1. Use any standard cuvette, 12 xSpectraMax® iD3 and iD5 Multi-Mode Microplate Readers can measure absorbance, fluorescence and luminescence. Monochromator wavelength selection saves you the time and trouble of ever having to. Vice President Sales and Marketing. The Molecular Devices SpectraMax M5E is a multi-mode plate reader that delivers single mode reader performance with five preferred detection modes for a wide range of applications. Molecular Devices. 6 to 384-well plates, LVis Plate with sixteen 2 µL microspots; Get Quote. 1. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. The SpectraMax® absorbance spectrophotometers and plate readers provide the versatility and convenience for a wide range of assays such as ELISAs, nucleic acid and protein quantitation, and microbial growth. By utilizing the optimized instrument settings suggested within this Application Note, Z' values > 0. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. We have a great online selection at the lowest prices with Fast & Free shipping on many items!384-well (75 µL) 0. ELISAs/EIAs. Both the SpectraMax M5 and the Gemini EM are monochromator-based, microplate readers. Narrow bandwidths deliver increased measurement accuracy and linearity over the widest range of assays, including. The optical system of the SpectraMax 340PC384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for. Regularly used for NADPH ATPase assays, and BCA assays. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in absorbance, fluorescence, luminescence, time-resolved fluorescence (TRF), and tunable fluorescence polarization (FP) read modes. Digital controller and display. Published Dec 16, 2020 | Updated Dec 16, 2020. Clamp for injector 1 is on the left and clamp for injector 2 is on the right. Molecular Devices SpectraMax 384 Plus Microplate Reader. 滤光片型光吸收微孔板读板机（酶标仪），简单易用，性价比高，检测结果精确. 8 (W) x 15 (D)This SpectraMax Plus 384 Spectrophotometer has been sold, but you can view our other spectrophotometers currently available for purchase here: Plus384, 190, 340PC384, and VersaMax Installation Guide Author: Molecular Devices Subject: Installation Guide Keywords: SpectraMax Versa and others Detection Platform Created Date: 5/17/2023 2:14:27 PMOn SpectraMax L, 1 RLU = 1 count per second for photon counting mode only. Optimized for 96- and 384-well plates, the Multi-Mode Detection Cartridge provides a broad array of measurement capabilities: Fluorescence Intensity (FI), Time. SpectraMax iD3 reader with touchscreen and inserted USB flash drive. The plate reader optics are. View the LabX ads below to find Molecular Devices SpectraMAX plate readers for sale and. The new SPECTRAmax® PLUS 384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. This user guide provides detailed instructions, troubleshooting tips and technical specifications for these instruments. By measuring optical pathlength, it eliminates the last major distinction between microplate readers and spectrophotometers. SpectraMax M2e Plate Reader; Application: Absorbance Concentration of Nucleic Acid: Fluorescence Concentration of RNA or DNA: Absorbance, Florescence, Luminescence RNA, DNA, Proteins: Range: 10ng-3000 ng (Accuracy diminishes less than 20 ng/µl and above 1500 ng/µl) RNA Broad Range: 20-1000 ng RNA: 5-100 ng DNA Broad Range: 2. 030 fmol Fluorescence Polarization (FP). dual monochRomatoRs foR assay flexibility With SpectraMax Multi-Mode Readers, there is no need to utilize expensive filters to optimize detection levels and background. Our microplate readers and software are the industry’s most cited and have empowered life science researchers to advance protein and cell biology. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Fluorescence filters included in 1nm range. , FI 15 sec. 5 pg/µL to 200 ng/µL. 003 fmol 0. Detection modalities are shown in Table 1-1. Perform the following steps to install the drivers: Start > Control Panel > System. Fixed a problem in SpectraMax Gemini setup when switching to luminescence where range checking errors were reported incorrectly. BOE offers an extensive inventory of competitively priced Lab Equipment. 0 OD for earlier models. ‘StimB’ is Stimulation Buffer, included in the IP-One Gq kit. SpectraMax® iD3, iD5, ABS, and ABS Plus readers, and up to 2. Categories:. The Molecular Devices SpectraMax® M5/M5e Microplate Reader was tested for compatibility with Life Technologies GeneBLAzer® assays. 4% in white 96- and 384-well microplates Sensitivity (ATP-Glow) Optimized 96 wells 3 pM 384 wells 6 pM. For more sample throughput, the system can be. SpectraMax 340PC384: SpectraMax Plus384: VERSAmax: Vmax: Tecan: Sunrise: Trinean: DropSense96: AMBIENT TEMPERATURE STORAGE: Liconic: LPX 220 Hotel: LPX 440 Hotel:. 9. The SpectraMax® ABS Plus Microplate Reader can run both cuvette-based and microplate reader applications on the same instrument. Upon completion of a plate read, data are delivered to your computer in an Excel-compatible format. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. Detects signal from either fluorescence or luminescence based assays. However, for greater flexibility, some instruments can accommodate 6- to 1536-well plate formats. SpectraMax® i3 Multi-ModeDetectionPlatform withtheSpectraMax® MiniMax™ImagingCytometer UserGuide 5025027A April2013. Molecular Devices Spectramax Plus 384 Microplate Reader is available from The Lab World Group. The SpectraMax L reader is upgradeable to dual-channel configurations for a 2-fold. For fluorescence intensity assays, the SpectraMax® M2 and M2e units feature an. As a generous estimate, you might consider 300 W (at 120 Volts) per Spectramax reader, plus another 300 W for the Computer. Shaker time 0 to 999 seconds Temperature range Ambient +4°C to 45°C General specifications Dimensions (in. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. 96-, 384-, and 1536-well plates (depending on. If using test tubes, read the absorbance of each tube in the cuvette port of the SPECTRAmax PLUS microplate spectrophotometer. Perform your favorite applications with a user-friendly reader that accommodates plate types from six to 384-well formats; up to. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. The SpectraMax M2 and M2e systems provide the multi detection microplate readers with dualmonochromators, dual-mode cuvette ports, with top & bottom reading. This integrated system. Compact design. 2. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. 997 (n = 3). Detection modalities are shown in Table 1-1. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. Browse for different fluorescent readers below and compare across different instrument suppliers. Read one sample or up to 384 at a time – it’s your choice. Temperature control. Cell viability는 세포막 Integrity 또는. 0 nm increments Wavelength Bandwidth: 2 nm Wavelength Accuracy: < ± 2. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. With the SpectraMax® MiniMax™ 300 Imaging Cytometer, industry-leading SoftMax® Pro Software, and user. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Multimode Readers Comparison Chart. 384 wells < 45 sec. formats from 6- to 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. Eight different automated tests are provided: • Absorbance accuracy (linearity) • Precision (reproducibility) • Stray light • Wavelength accuracy • Wavelength repeatabilityThe SpectraMax® ABS Plus Microplate Reader can run both cuvette-based and microplate reader applications on the same instrument. Used MOLECULAR DEVICES SPECTRAmax 384 Spectrophotometer For Sale - DOTmed Listing #2356563: Spectra Max Plus 384 Microplate Spectrophotometer - GOOD WORKING UNIT Equipment was recently removed. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Molecular Devices SpectraMax 384 Plus Microplate Reader. The optical performance is comparable to a top-of-the-line dedicatedSpectraMax M Series Multi-Mode Microplate Readers 3. Create custom fluorescence assays without having to purchase expensive filter sets. Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. With optimized reagents and the industry-leading data acquisition and analysis tool, SoftMax Pro® 7 Software, the SpectraMax® iD3 allows users to customize workflow to perfectly. ester flash assays, in both 96- and 384-well plates. Dimensions: 128mm (L) x 86mm (W) x. Tb donor/red acceptor. The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. It can be upgraded with modules such as imaging cytometer, western blot imager, and injectors to expand its capabilities. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. Keywords: spectramax m2 systems, spectramax m2e systems, spectramax m2/m2e readers, pathcheck sensor, spectratest abs1 absorbance, stakmax stacker Created Date: 5/20/2019 9:24:38 AM SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. To prevent such interference, select the Interlaced Reading option to read every other well in a checkerboard pattern in the first run and then read the previously omitted wells in a second run. Assay Kits. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. The SpectraMax Paradigm Multi-Mode Detection. Keywords spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software. Typically the system can detect absorbance, luminescence, fluorescence, and even make more specialized fluorescence measurements like time-resolved fluorescence (TRF) and fluorescence polarization (FP). Read one sample or up to 384 samples in a single plate by using any standard cuvette, or 96- or 384-well microplate. TheSpectraMax®Plus384addstheabilitytoreadcuvettes. 5065390D 3 Contents SafetyInformation 4 Warnings,Cautions,Notes,andTips 4 Chapter1:Introduction 7 ComputerIntegration 8 PlateControls 9 CuvetteChamber 10 Multimode Reader Comparison Chart. SPECTRAmax PLUS Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific pro-teins, nucleic acids, and other molecules across a wide range of concentrations. Light Source: Xenon flash. Molecular Devices Microplate Reader Spectramax 384 340PC. . The PathCheck Sensor is a temperature independent feature from Molecular Devices that measures the optical pathlength of samples in microplate wells. SpectraMax® Plus 384 provides ultrafast, full spectral range. spr SpectraMax Plus 384. Figure 1. Shaking capabilities. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. Fluorescence Intensity top and bottom capabilities. This white, polystyrene ProxiPlate™ has shallow wells allowing for lower volumes to be used in assays. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. An ATP standard curve spanning five decades was run using the ATPlite 1step Luminescence Assay System (PerkinElmer) on the SpectraMax iD3 reader. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Before you do a bottom read, or use high profile (6-well, 12-well, 24-well, or 48-well) plates, you must remove the plate adapter from the plate drawer. Top or bottom detection is available at the touch of a button. SpectraMax i3x Injector Cartridge with SmartInject® Technology. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. SpectraMax® 340PC384 microplate reader provides everything needed to measure absorbance in the visible range, including temperature control, a robotics-compatible interface and SoftMax® Pro data analysis software. The optical performance is comparable to a top-of-the-line dedicatedUnparalleled performance on a personalized platform. On LabX buyers can find a variety of SpectraMAX models for sale: 190, 384, 340 and the SpectraMAX M series. Beer-Lambert Law states that. Validate the optical performance of your absorbance . 10822 512. SpectraMax and VersaMax Plate Readers OperatorÕs Manual Ñ 0112-0126 Rev A SpectraMax Plus 384 SpectraMax 190 SpectraMax 340PC 384 VersaMax Microplate Spectrophotometer Operator's Manual Molecular Devices Corporation 1311 Orleans Drive Sunnyvale, California 94089 Part # 0112-0126 Rev A. E = absorptivity (extinction coefficient) C = concentration = pathlength. Application note showing how SpectraMax® i3x and SpectraMax®iD5 Multi-Mode Microplate Readers are used to performGq-coupled receptor assays using HTRF technology. 1) All parts of the SPECTRAmax 340PC 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. On the front panel of the instrument, press the load/eject button to move the microplate drawer outside of the instrument. In addition, the SpectraMax iD5 The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. Industry-leading SoftMax® Pro Microplate Data Acquisition and Analysis Software eliminates the need to export data The SpectraMax ABS Plus, can accommodate standard 96-well plates and 384-well plates. Monochromator, tunable 1. Reference diodes enable elimination of measurement noise due to slight fluctuations in. SoftMax Pro Software, the industry-leading microplate reader software for the SpectraMax Plus 384 system, allows complete customization of data collection and. Essentially, all UV/VIS spectrophotometric assays that are read in a conventional spectrophotometer or micro plate reader can be read in the SpectraMax Plus: DNA/RNA/protein quantitation and purity. It is upgradeable to include a barcode reader,. The SpectraMax® Plus 384 adds the ability to read cuvettes. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Each SpectraMax® 340 PC 384 Microplate Reader has an. 9 in. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. 2 pM 2 pM 384-well (50 µL) 3 pM 4 pMThe SpectraMax i3 Multi-Mode Detection Platform is a versatile instrument that can perform various assays and measurements on microplates and cuvettes. Using the patented PathCheck® Pathlength Measurement Technology, the SpectraMax M4 Microplate Reader transforms each well in a microplate to a fixed. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Molecular Devices’ SpectraMax® Plus 384 Microplate Reader provides fast and reliable full spectral range detection for cuvettes, 96-well and 384-well microplates. Accurate quantitation TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes acrossawiderangeofconcentrations. Features. Fluorescence Microplate Reader Comparison Chart. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). The optical performance is comparable to a top-of-the-line dedicatedSpectraMax 340PC384的光学设计真实地模 拟双光束分光光度计。每个孔有其各自的 样品光束检测和参比检测。8通道的系统， 包含8条样品检测光束和8条参比光束，给 予出众的精确度和高速读板方式。 不需要滤光片 SpectraMax 340PC384使用光栅单色器代替 滤光片。Explore more about Optimized settings for Transcreener TR-FRET assay on SpectraMax iD5 and SpectraMax i3x readers. Service parts for these models are not being produced and are no longer in stock. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. Or, with the reader specifications noted from the Instrument Description section of your reader's manual, as well as those for your PC, you can calculate needs more closely. Model: SpectraMax PLUS 384. Analyst, M5, Flex 3, and SpectraMax L readers work differently. Regularly used for NADPH ATPase assays, and BCA assays. It measures the optical density (OD) of samples in both 96- and 384-well. In addition, users can define individual reagents and concentrations to be delivered to eachMolecular Devices Microplate Reader Spectramax 384 340PC. Avantor is setting science in motion for a better world | Avantor - VWROverview of 384-Well High Sample Recovery Plate. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. You can use 6, 12, 24, 48, 96, and 384-well plates that conform to ANSI/SBS standard microplate footprint and dimensions in the instrument. Molecular Devices Spectramax 384 Plus Microplate Reader. Select ‘Water Constant’ in the Instrument Settings dialog box (Figure 3). Use any standard cuvette, 12 x 75 mm test tube, 96- or 384-well. Temperature control and microplate-shaking included. Supplier: Molecular Devices. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in. No accessories are needed and SoftMax® Pro Software. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. used. spectramax id3 multi-mode microplate reader, spectramax id3, softmax pro 7 software, spectramax id3 injector system. Absorbance = E * C * L. Minimum volume and maximum throughput with 96- or 384. These VWR® Plus Series stainless steel refrigerators feature a multi-functional design for laboratory use. ester flash assays, in both 96- and 384-well plates. The SPECTRAmax™ GEMINI XS Dual-Scanning Microplate Spectrofluorometer. Contains one microplate adapter, five 24-well low volume slides, five 64-well low volume bottom slides, and five of each cover slide (2 µL and 4 µL) 0200-6267. Top detection is available for fluorescence detection on the SpectraMax M2, while top and bottom reads are possible on the SpectraMax M2 . For more sample throughput, the system canThis version is compatible with the following instruments: SpectraMax® Mini Multi-Mode Microplate Reader (software version 7. 3) This warranty covers the SPECTRAmax PLUS 384MOLECULAR DEVICES SPECTRA max PLUS 384 Microplate Reader from Bid On Equipment. One plate carrier adapter is provided with the instrument. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. With the SpectraMax® MiniMax™ 300 Imaging Cytometer, industry-leading SoftMax® Pro Software, and user. Microplate Spectrophotometer. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax 340PC384 reads 96-well plates and 384-well plates. The LMax plate reader has similar calculations and its RLUs are comparable to those of LMax II 384. 2 or higher, standard edition only, no GxP) VersaMax™ Microplate Reader (Serial numbers begining with BNxxxxx and BNRxxxxx are supported) SpectraMax® 190 Absorbance Microplate Reader (Serial numbers. SpectraMax® Plus 384 Absorbance Plate Reader, Molecular Devices. The SpectraMax i3x reader has variable bandwidth for fluorescence and luminescence, and you are able to choose either 9nm or 15 nm for excitation and either 15 nm or 25 nm for emission. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution designed to expand the boundaries of research capabilities. Key features 4 wells: 76 seconds Luminescence Specifications Dynamic Range < 6 decades Sensitivity 10 amol ATP General Specifications. Note: Additional readers with similar performance are listed. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. 00 USD BMG FLUOstar Omega Microplate Reader Unit2 - AV $10,295. Features. 996 (n = 3) ; for SpectraMax Plus 384 reader, r 2 = 0. 4% in white 96- and 384-well microplates Sensitivity (ATP-Glow) Optimized 96 wells 3 pM 384 wells 6 pM. spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software, spectramax i3 platform. !Pathchecklm1000. used. Published Dec 16, 2020 | Updated Dec 16, 2020. 100 fmol 384-well (75 µL) 0. Published Dec 16, 2020 | Updated May 19, 2023. Regularly used for NADPH ATPase assays, and BCA assays. Catalog Number. With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. Check: In the data table create two new columns and add the following formulas: !Pathchecklm900. Molecular Devices, LLC. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselected wavelengthsinasinglereadmode. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. 5065390D 3 Contents SafetyInformation 4 Warnings,Cautions,Notes,andTips 4 Chapter1:Introduction 7 ComputerIntegration 8 PlateControls 9 CuvetteChamber 10Multimode Reader Comparison Chart. Fluorescent detection is achieved from the top, through the entire depth of sample in the microplate well. The SpectraMax ® Plus 384 Microplate Reader gives you walk-up convenience for both standard spectrophotometer and microplate reader applications on the. SpectraMax Gemini XPS/EM Register or Sign In. This product is no longer available on Biocompare. Wavelength Range. For. Meso Scale Discovery 1250 Sector Imager 2400. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and. 2. <p>384-well transparent tissue-culture treated (TC-treated) microplate for cell-based absorbance (colorimetric) assays. The . used. The SPECTRAmax™ 340PC 384 microplate spectrophotometer provides rapid and sensitive measurements of a variety of analytes across a wide range of concentrations. The eight-channel system delivers both high precision and speed when reading 96- and 384-well microplates for endpoint measurements, kinetic assays, and spectral scans. Results were presented as mean ± standard deviation. If desired, the samples can be transferred into cuvettes before reading. A microplate reader as The SpectraMax® i3x Multi-Mode Microplate Reader measures absorbance, fluorescence, and luminescence with available upgrades including western blot, cell imaging, and fast kinetics with injectors plus additional detection modes. and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. It is an innovative way of normalizing the absorbance reading in a microplate well to that of a 1-cm cuvette. </p> <p>Tissue-culture treated microplates are supplied with lids except when supplied in a case of 200 microplates. SpectraMax M2, M2e; SpectraMax M3, M4, M5, M5e; FilterMax™ Multi-Mode Detection Platform. Biocompare is the leading resource for up-to-date product information, product reviews, and new technologies for life scientists. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate. Below is the list of Molecular Devices microplate readers and liquid handling instruments that are of out-of-production and are now considered obsolete. Tailored to your different needs, these kits are configured and optimized for Molecular Devices SpectraMax® microplate readers with preconfigured protocols provid- The SpectraMax® iD3 Multi Mode Microplate . For more sample throughput, the system can be. 6 (H) x 22. Detection modalities are shown in Table 1-1. Measurement of tannin, iron-reactive phenolics, anthocyanin and polymeric pigment in red wine is an important part of quality control in the wine industry. Molecular Devices SpectraMax Plus 384. Also refer to this Multimode Reader Comparison Chart. These upright laboratory refrigerators will fulfill all general-purpose applications, with adequate space for ventilation. The PA 800 Plus system is a robust analytical, kit-based platform that can help you with: Purity/Heterogeneity with gold standard CE-SDS in minutes. Detection modalities are shown in Table 1-1. Clearance . spr SpectraMax M2 M2e M3 M4 M5 M5e SpectraTest ABS2 v1. It provides ready-to-run protocols, analysis algorithms, and 21 different curve fit options. The SpectraMax iD3 reader is fully compatible with the SpectraDrop™ Micro Volume Microplate, enabling quantitation of precious low volume samples. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Standard features include a cuvette port, spectral scanning in 1 nm increments, and up to six wavelengths per read. no. The Spectramax 190 has an array of data collection modes, including kinetic, endpoint, and spectral scan modes. In addition, the iD5 reader can measure TRF and FP, and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter gene detection with syringe and Western blot detection. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. FilterMax F3 and F5 Multi-Mode; SpectraMax Paradigm® Multi-Mode. Abs 49 sec. Manufacturer: Molecular Devices; Model: SpectraMax; Will included PC workstation w/ preloaded softmax pro software Wavelength Range: 340 – 850 nm Wavelength Selection: Monochromator, tunable 1. SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. 6. Sold as-is. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Fluorescent Polarization: Solid black plates, as above. Accessories and spare parts for microplate dispensers, Multidrop 384 and DW. SpectraMax® M5e Multi-Mode Microplate Reader performance with an integrated 8- or 16-channel pipettor into one compact benchtop reader. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. The SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. . Next generation SpectraMax® absorbance microplate readers. For more sample throughput, the system canThe SpectraMax M2 is a dual-monochromator, multi-detection microplate reader with a dual-mode cuvette port and 96 or 384 microplate reading capability. Cross-talk < 0. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. spectramax, i3x, spectramax i3x, detection cartridge, spectramax i3x injector cartridge, smartinject technology, atp a, spectramax i3x multi-mode microplate reader, luminescent cell. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. 384-well microplate for use in time-resolved fluorescence, luminescence, Alpha, and radiometric assays. Molecular Devices SpectraMax ® Quant family of dsDNA quantitation kits allows for very accurate quantitation of dsDNA in a linear range from 0. Detection of species collected on membrane plates is also. Molecular Devices also offers a mass spectrometry-based solution for food safety testingThe SPECTRAmax™ GEMINI XS Dual-Scanning Microplate Spectrofluorometer. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and microplate drawer. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). Service Contracts, Preventative Maintenance and Performance. The value for 1000 should be higher than the value for 900.